close

Вход

Забыли?

вход по аккаунту

2 509 805(13) C2

код для вставкиСкачать
РОССИЙСКАЯ ФЕДЕРАЦИЯ
(19)
RU
(11)
2 509 805
(13)
C2
(51) МПК
C12N 15/70
C12N 15/09
(2006.01)
(2006.01)
ФЕДЕРАЛЬНАЯ СЛУЖБА
ПО ИНТЕЛЛЕКТУАЛЬНОЙ СОБСТВЕННОСТИ
(12) ОПИСАНИЕ
ИЗОБРЕТЕНИЯ К ПАТЕНТУ
(72) Автор(ы):
Смирнова Мария Сергеевна (RU),
(24) Дата начала отсчета срока действия патента:
Леонович Оксана Александровна (RU),
12.04.2012
Казеева Тамара Николаевна (RU),
Мутных
Елена Сергеевна (RU),
Приоритет(ы):
Папуниди
Константин Христофорович (RU),
(22) Дата подачи заявки: 12.04.2012
Маракасова Екатерина Семеновна (RU),
(43) Дата публикации заявки: 20.10.2013 Бюл. № 29
Филимонова Нина Александровна (RU),
Осипенкова Ольга Валерьевна (RU),
(45) Опубликовано: 20.03.2014 Бюл. № 8
Белякова Алла Владимировна (RU),
Зылькова Марина Валерьевна (RU),
(56) Список документов, цитированных в отчете о
Шевелев Алексей Борисович (RU)
поиске: ЛАТЫПОВ О.Р. Характеристика новых
бета-пропеллерных белковых доменов,
(73) Патентообладатель(и):
гомологичных фолдону фибритина
Федеральное государственное бюджетное
бактериофага Т4: автореферат диссертации
учреждение "Институт полиомиелита и
по ВАК 03.00.04. Казань, 2008, 84 с.
вирусных энцефалитов им. М.П. Чумакова"
LUDMILLA SISSOEFF et al., Stable trimerization
РАМН (RU)
of recombinant rabies virus glycoprotein
ectodomain is required for interaction with the
p75NTR receptor, Journal of General (см. прод.)
2 5 0 9 8 0 5
C 2
R U
2 5 0 9 8 0 5
Адрес для переписки:
142782, Московская обл., Ленинский р-н,
поселок сельского типа Институт
Полиомиелита, 27 км Киевского ш., Н.А.
Филимоновой
(54) СПОСОБ ПОЛУЧЕНИЯ РЕКОМБИНАНТНОГО АНТИГЕНА G2 ХАНТАВИРУСА
ДОБРАВА В КЛЕТКАХ E.coli
(57) Реферат:
Изобретение
относится
к
области
биотехнологии и касается способа получения
рекомбинантного антигена G2 хантавирусов.
Представленный способ характеризуется тем,
что ДНК конструкции pGHF, кодирующая
слитый белок из трех частей, где N-концевое
положение занимает зеленый флуоресцентный
белок GFP, центральное - пептид длиной 73 а.о.
с последовательностью
аминокислот
SRKKCNFATTPICEYDGNMVSGYKKVMATIDS
FQAFNTSYIHYTDEQIEWKDPDGMLKDHLNIL
VTKDIDFDT, а C-концевое - мини-домен
фолдон фибритина колифага JS98C3 (фиг.2),
вводят
в клетки
E.coli,
культивируют
трансформированные данной конструкцией
клетки,
лизируют
биомассу,
отделяют
нерастворимую
фракцию
лизата
центрифугированием, продукт экспрессии в
форме телец включения солюбилизируют с
помощью
денатурата,
проводят
хроматографию и используют полученный
продукт для выявления специфических антител
в
сыворотке
больных
геморрагической
лихорадкой
с
почечным
синдромом.
Представленное решение позволяет улучшить
воспроизводимость
и
чувствительность
иммуноферментного анализа при диагностике
ГЛПС. 7 ил.
Ñòð.: 1
ru
R U
C 2
(21)(22) Заявка: 2012114473/10, 12.04.2012
R U
R U
2 5 0 9 8 0 5
C 2
C 2
2 5 0 9 8 0 5
(56) (продолжение):
Virology, 2005, Vol.86, p.p.2543-2552. СЕРНОВА Н.В. Физико-химические свойства фибритина
бактериофага Т4 и применение его карбоксиконцевого домена в белковой инженерии, Автореферат
диссертации по ВАК 03.00.02. Долгопрудный, 2004, 107 с. ENGEL J et al., What are oligomerization
domains good for, Matrix Biol., 2000 Aug, Vol.19, No.4, p.p.283-8. US 20100204120 A1, 12.08.2010. RU
2445117 C2, 20.03.2012.
Ñòð.: 2
RUSSIAN FEDERATION
(19)
RU
(11)
2 509 805
(13)
C2
(51) Int. Cl.
C12N 15/70
C12N 15/09
(2006.01)
(2006.01)
FEDERAL SERVICE
FOR INTELLECTUAL PROPERTY
(12) ABSTRACT
OF INVENTION
(21)(22) Application: 2012114473/10, 12.04.2012
(24) Effective date for property rights:
12.04.2012
(43) Application published: 20.10.2013 Bull. 29
(45) Date of publication: 20.03.2014 Bull. 8
(73) Proprietor(s):
Federal'noe gosudarstvennoe bjudzhetnoe
uchrezhdenie "Institut poliomielita i virusnykh
ehntsefalitov im. M.P. Chumakova" RAMN (RU)
2 5 0 9 8 0 5
R U
(57) Abstract:
FIELD: chemistry.
SUBSTANCE: invention relates to biotechnology
and a method of obtaining a recombinant antigen G2
of hantaviruses. The disclosed method is
characterised by that the DNA structure pGHF, which
encodes a fused protein of three parts, where Nterminal position is occupied by a green fluorescent
protein GFP, central position is occupied by a
peptide of 73 amino acid residues with the amino acid
sequence
SRKKCNFATTPICEYDGNMVSGYKKVMATIDS
FQAFNTSYIHYTDEQIEW
KDPDGMLKDHLNILVTKDIDFDT, and the Cterminal position is occupied by a mini-domain
Foldon of coliphage fibritin JS98C3 (dwg 2), is
introduced into E. coli cells; cells transformed by
this structure are cultured, the biomass is lysed,
the insoluble fraction of the lysate is separated by
centrifuging, the product of expression in the form
of inclusion bodies is solubilised with methylated
spirit, chromatography is carried out and the
obtained product is used to detect specific
antibodies in serum of patients with hemorrhagic
fever with renal syndrome.
EFFECT:
disclosed
solution
improves
repeatability and sensitivity of immunoenzymatic
assay when diagnosing hemorrhagic fever with renal
syndrome.
7 dwg
Ñòð.: 3
en
C 2
C 2
(54) METHOD OF OBTAINING RECOMBINANT ANTIGEN G2 OF DOBRAVA HANTAVIRUS IN E.coli
CELLS
2 5 0 9 8 0 5
Mail address:
142782, Moskovskaja obl., Leninskij r-n, poselok
sel'skogo tipa Institut Poliomielita, 27 km
Kievskogo sh., N.A. Filimonovoj
R U
Priority:
(22) Date of filing: 12.04.2012
(72) Inventor(s):
Smirnova Marija Sergeevna (RU),
Leonovich Oksana Aleksandrovna (RU),
Kazeeva Tamara Nikolaevna (RU),
Mutnykh Elena Sergeevna (RU),
Papunidi Konstantin Khristoforovich (RU),
Marakasova Ekaterina Semenovna (RU),
Filimonova Nina Aleksandrovna (RU),
Osipenkova Ol'ga Valer'evna (RU),
Beljakova Alla Vladimirovna (RU),
Zyl'kova Marina Valer'evna (RU),
Shevelev Aleksej Borisovich (RU)
C 2
C 2
2 5 0 9 8 0 5
2 5 0 9 8 0 5
R U
R U
Ñòð.: 4
RU 2 509 805 C2
5
10
15
20
25
30
35
40
45
50
Область техники, к которой относится изобретение: Изобретение относится к
области биотехнологии, в частности, к получению рекомбинантного антигена G2
хантавирусов с характеристиками, позволяющими улучшить воспроизводимость и
чувствительность иммуноферментного анализа при диагностике ГЛПС.
Уровень техники: геморрагическая лихорадка с почечным синдромом (ГЛПС) вирусный нетрансмиссивный зооноз, занимает в России ведущее место по числу
заболевших среди природно-очаговых инфекций.
Наиболее эффективным методом борьбы с ГЛПС является специфическая
профилактика, то есть вакцинация населения эндемичных регионов [1-3]. В настоящее
время коммерческие вакцины против ГЛПС производятся только в Китае, однако ни
одна из этих вакцин не может применяться в европейских регионах России, так как не
обеспечивает защиты от вирусов Пуумала и Добрава - возбудителей ГЛПС в этих
регионах [4-7].
Для изготовления и контроля вакцины против вирусов Пуумала и Добрава
необходимо решить проблему разработки эффективных серологических методов на
основе белков внешней оболочки - энвелопа хантавирусов. Однако до настоящего
времени задача получения полноразмерных коммерческих препаратов белков
энвелопа G1 и G2 хантавирусов не решена нигде в мире, что обусловлено их
токсичностью по отношению к бактериальным клеткам.
Недавно был получен рекомбинантный антиген НТ-Δ12, представляющий собой
фрагмент белка G2 хантавируса Добрава, сохраняющий иммуногенность
полноразмерного продукта, но не проявляющий токсичности по отношению к
клеткам продуцента (пат. заявка RU №2010141819 от 13.10.2010). При этом данный
белок накапливался в клетках E.coli в виде телец включения [8-10]. Вследствие этого,
при использовании антигена НТ-Δ12 в иммунологических тестах, необходимо
проводить предварительную ренатурацию продукта, что в свою очередь негативно
сказывается на чувствительности и воспроизводимости иммунологического теста.
Целью нашей работы является разработка способа повышения качественных
характеристик антигена НТ-Δ12 за счет изменения его структуры.
Раскрытие изобретения: сущностью изобретения является способ повышения
качественных характеристик рекомбинантного антигена G2 (НТ-Δ12) для его
использования в иммунологических тестах при диагностике ГЛПС благодаря
улучшению растворимости целевого белка-антигена G2 хантавируса Добрава за счет
стабилизации его глобулярной структуры бета-структурным мини-доменом фолдона
фибритина колифага JS98C3. Таким образом, настоящее изобретение относится к
способу получения белка-антигена G2 хантавируса Добрава с заданными
качественными характеристиками (белок GHF) для повышения воспроизводимости и
чувствительности иммуноферментного анализа при диагностике ГЛПС. Способ
предусматривает следующие стадии:
1) получение плазмидной конструкции pGHF, несущей трифункциональный слитой
ген;
2) экспрессия и анализ выхода белка GHF;
3) хроматография белка GHF на колонке Sepharose 6 FF;
4) проведение иммунохимических тестов.
Краткое описание графических изображений:
Фиг.1. Плазмидная конструкция pGHF принципиальная схема.
Фиг.2. Последовательность трифункционального слитого гена, кодирующего
производное пептида НТ, в составе конструкции pGHF.
Ñòð.: 5
DE
RU 2 509 805 C2
5
10
15
20
25
30
35
40
45
50
- Последовательность гена GFP подчеркнута волнистой линией;
- Последовательность гена пептида НТ из состава кДНК вируса Добрава
закрашена серым;
- Последовательность гена фолдона фибритина подчеркнута пунктиром;
Фиг.3. Электрофоретический анализ продуктов экспрессии конструкции pGHF в
растворимой (1) и нерастворимой (2) фракции лизата клеток Е.coli JM109,
затрансформированных конструкцией pGHF. Белки разделены в денатурирующем 15%
ПААГ. На рисунке (а) показан общий белок (гель окрашен Coomassie Blue R-250), на
рисунке (б) представлено свечение белка в геле под УФ-излучением.
Фиг.4. Хроматография белка GHF на колонке Sepharose 6 FF. Оптическая плотность
при λ=280 нм представлена на графике (1).
Пунктирными линиями обозначен диапазон фракций, содержащих белок GHF (В1В8).
Фиг.5. Изучение антигенной активности белка GHF методом твердофазного
иммуноферментного анализа. Планшеты активированы белками-антигенами GHF (а)
и НК6 (б). Пулы сывороток крови больных ГЛПС (вирусы Добрава, Пуумала,
Хантаан) и здоровых доноров использовали в разведении от 50 до 3200 раз с шагом 2
раза. На оси ординат указана величина А4 5 0 каждой точки за вычетом фона
(контроль без добавления сыворотки человека). На графиках представлены реакции
белков-антигенов с сыворотками крови больных ГЛПС (1) и с сыворотками крови
здоровых доноров (2).
Осуществление изобретения:
Методология исследования:
1) получение конструкции pGHF,
2) экспрессия и анализ выхода белка GHF,
3) хроматография белка GHF,
4) проведение иммунохимических тестов.
1) Получение конструкции
Получение конструкции проводили по следующей схеме:
В ранее описанную конструкцию рЕТ-НТ-Δ12 (пат. заявка RU №2010141819
от 13.10.2010), несущую ген пептида НТ, клонировали ген фолдона фибритина из
конструкции pET-cd-32a [11]. При этом и векторную конструкцию рЕТ-НТ-Δ12
расщепляли по сайтам SpeI и, XhoI, а вставку из конструкции pET-cd-32a извлекали
рестрикцией по сайтам XbaI и XhoI.
Далее в уникальный сайт XbaI полученной конструкции на базе вектора рЕТ23а
вводили синтетический ДНК-дуплекс, составленный из заранее фосфорилированных
олигонуклеотидов:
5' CTAGCGGGGGCGCCGGAGGA 3',
5' CTAGTCCTCCGGCGCCCCCG 3'.
Далее полученную конструкцию на основе рЕТ23а использовали в качестве
матрицы для ПЦР с уникальным праймером
5' ggagatctGCTAGCGGGGGCGCCGGAGGAATTAATTCgag 3'
и со стандартным праймером T7terminator.
Полученный продукт ПЦР длиной 600 п.н. расщепляли рестриктазами BglII и XholI
и клонировали в вектор pGem3z, расщепленный по сайтам BamHI и SalI.
Вставку «НТ+ фолдон фибритина» из конструкции pGem3z извлекали рестрикцией
по сайтам SacI и PstI и клонировали в экспрессионный вектор pQE30-GFP, содержащий
ген зеленого флуоресцентного белка GFP на базе вектора pQE30 (Qiagen) [12] по тем
Ñòð.: 6
RU 2 509 805 C2
5
10
15
20
25
30
35
40
45
50
же сайтам.
В составе конструкции (фиг.1 и 2) можно выделить следующие элементы:
- экспрессионный вектор pQE30 (Qiagen);
- ген зеленого флуоресцентного белка GFP (Evrogen);
- фрагмент полилинкера вектора pGem-3z (Promega);
- ген Ht из конструкции рЕТ-НТ-12;
- фрагмент полилинкера вектора pGem-3z (Promega);
- ген фолдона фибритина фага JS98C3 [11].
2) Экспрессия и анализ выхода белка
Конструкцию pGHF вводили в клетки штамма Е.coli JM109. Селекцию колоний
осуществляли по двум параметрам: по ампицилиноустойчивости и по наличию
зеленой флуоресцентной окраски колоний. Полученный продуцент культивировали
при 30°С в жидкой среде (0,5% дрожжевой экстракт, 1% пептон, 0,5% NaCl) с
добавлением 100 мкг/мл ампициллина в колбах Эрленмейера объемом 750 мл (30 мл
среды на колбу) в течение 14-18 часов. Посевной материал представлял собой смыв
культуры клеток с чашек с агаризованной средой (0,5% дрожжевой экстракт, 1%
пептон, 1,5% агар, 0,5% NaCl), полученных высевом первичных трансформантов.
Возраст трансформантов - около 40 часов с момента окончания трансформации,
температура культивирования - 30°С. Доза засева - 5×108 клеток на колбу. Индукцию
промотора в клетках продуцента проводили IPTG.
Оценку накопления целевого продукта в клетках Е.coli осуществляли с помощью
электрофоретического анализа суммарных белков рекомбинантного продуцента по
Лэммли. Для этого из грубого клеточного лизата каждой культуры отбирали по 100
мкл. Лизат подвергали центрифугированию при 14000 G. в течение 15 мин и разделяли
растворимую и нерастворимую клеточную фракции. Белки солюбилизировали в 30
мкл буфере Лэммли и анализировали состав белков с помощью
денатурирующего SDS-электрофореза в 15% ПААГ (фиг.3). Флуоресцентное свечение
белков растворимой фракции в геле наблюдали в районе 47 кДа, что соответствует
расчетной массе белка GHF. Белки нерастворимой фракции флуоресцентного свечения
не имели.
3) Хроматография белка
Грубый клеточный лизат культуры JM109 (GHF) подвергали центрифугированию
при 8000 G. в течение 1 часа и разделяли растворимую и нерастворимую клеточную
фракции. Белок из растворимой фракции подвергали первоначальной очистке путем
двойного высаливания сульфатом аммония. Первый осадок, полученный путем
осаждения 1,2% раствором (NH)4SO2, удаляли из фракции, последующий второй
осадок (после осаждения 2% раствором (NH)4SO2), содержащий целевой белок GHF,
собирали центрифугированием при 8000 G в течение 1 часа. Осадок суспендировали в 8
мл буфера (10 мМ Tris-HCl, 130 мМ NaCl, pH=7,8).
Основной целью хроматографии белка - производного пептида НТ в
денатурирующих условиях являлось удаление примесей нуклеиновых кислот,
формирующих коллоид с участием белков и препятствующих эффективному
применению других методов хроматографии. При этом удаление из препарата
примесей клеточных белков Е.coli рассматривалась лишь как побочная задача.
Полученный раствор белка GHF в объеме 15 мл наносили на колонку Sepharos 6 FF
(GE Healthcare, США, высота 24 см, объем 48 мл), уравновешенную буфером А.
Элюцию проводили линейным градиентом NaCl от 0 до 0,5 М в хроматографическом
буфере В (Tris-HCl, 100 мМ) со скоростью 8 мл/мин (фиг.4).
Ñòð.: 7
RU 2 509 805 C2
5
10
15
20
25
30
35
40
45
50
Фракции для дальнейшей работы, содержащие целевой белок GHF, отбирали,
оценивая присутствие флюоресцентной зеленой окраски в растворе. Отобранные
фракции по 10 мл объемом каждая объединяли и подвергали концентрированию и
очистке на HisLink Protein Purification Resin (Promega). Материал фракций белка GHF,
полученный в результате, оказался иммунохимически чистым и электрофоретически
гомогенным, что позволило непосредственно использовать его для проведения
иммунохимических тестов.
4) Проведение иммунохимических тестов
В качестве формата проведения анализа был выбран вариант тИФА с
непосредственной сорбцией рекомбинантного белка-антигена GHF на поверхность
иммунологического планшета. Препаратом для сравнения служил белок-антиген НК6.
В процессе сорбции белковые препараты GHF и НК6 разводили в 20-50 раз карбонатбикарбонатным буфером (КГБ), доводя концентрацию общего белка в растворе до 10
мкг/мл. Полученный раствор вносили в иммунологические планшеты на 1 сутки,
после чего проводили блокирование неспецифического связывания на подложке с
помощью 1% БСА в буфере КГБ. На следующей стадии проведения анализа
проводилось серийное титрование пулов сывороток крови больных ГЛПС и, в
качестве сравнения, здоровых доноров. При этом пул сывороток крови включал
больных ГЛПС, инфицированных вирусом Добрава, Пуумала и Хаантан. Сыворотки
крови брали в разведении от 50 до 3200 раз с шагом 2 раза. В качестве контрольного
образца использовали лунки планшета, в которые вместо разведенной сыворотки
человека вносили буфер PBS («конъюгатный контроль»).
В заключение все лунки планшета обрабатывали антивидовым конюгатом
против IgG человека, меченным пероксидазой, и субстратом ТМВ в присутствии
пероксида водорода. Сигнал мерили на планшетном сканере-спектрофотометре при
λ=450 нм. Результаты определений представлены на фиг.5.
Полученные результаты доказывают, что повышение растворимости
рекомбинантного антигена за счет изменения его структуры приводит к увеличению
разрешающей способности иммунологического анализа для диагностики ГЛПС.
Список использованных источников
1. Maes P., Clement J., Van Ranst M. Recent approaches in hantavirus vaccine development. Expert Rev Vaccines. - 2009 - V.8, №1, P.67-76.
2. Cho H.W., Howard C.R., Lee H.W. Review of an inactivated vaccine against hantaviruses. Intervirology. - 2002 - V.45, №4-6, P.328-333.
3. Song G. Epidemiological progresses of hemorrhagic fever with renal syndrome in China. Chin Med J (Engl). - 1999 - V.112, №5, P.472-477.
4. Oya A. Japanese encephalitis vaccine. - Acta Paediatr Jpn. - 1988 - V.30, №2, Р.175-184.
5. Choi Y. Ahn C.J., Seong K.M., Jung M.Y., Ahn B.Y. Inactivated Hantaan virus vaccine
derived from suspension culture of Vero cells. - Vaccine. - 2003 - V.21, №17-18, P.1867-1873.
6. Lee H.W., Chu Y. K., Woo Y.D. Immune responses after two or three doses of Hantavax
vaccination against Hantaan virus // Proc. fifth international conference on hemorrhagic fever
with renal syndrome, hantavirus pulmonary syndrome and hantaviruses. Lion, Franch - 2001. P.234-242.
7. Ruan Y., Xu X., Liu W„ Deng X, Weng S, Zhou W, Wang Q, Chen L, Fang L, Xu Z, Yan
Q, Liu W, Dong G, Gu H, Yu Y, Xu Z. A study on immunogenicity and safety of bivalent
inactivated vaccine against hemorrhagic fever with renal syndrome. - Zhonghua Yu Fang Yi Xue
Za Zhi. - 1999 - V.33, №6, P.340-342.
8. Hooper J.W., Kamrud K.I., Elgh F., Custer D., Schmaljohn C.S. DNA vaccination with
Ñòð.: 8
RU 2 509 805 C2
5
10
15
hantavirus M segment elicits neutralizing antibodies and protects against seoul virus infection.
- Virology. - 1999 - V.255, №2, P.269-278.
9. Kallio-Kokko H., Leveelahti R., Brummer-Korvenkontio M., Lundkvist A., Vaheri A.,
Vapalahti O. Human immune response to Puumala virus glycoproteins and nucleocapsid protein
expressed in mammalian cells. - J Med Virol. - 2001 - V.65, №3, P.605-613
10. Huang H., Li X., Zehua Z. Genetic immunization with Hantavirus vaccine combining
expression of G2 glycoprotein and fused interleukin-2. - Genetic Vaccines and Therapy. - 2008 V.6. - P.15-21.
11. Латыпов О.Р., Голомидова А.К., Летаров А.В. Характеристика продукта
гена wac бактериофага JS98C3, близкородственного фагу JS98 // Вестник КГУ. 2007.
Т.149. С.112-122.
12. Шевелев А.Б., Хоменков В.Г., Кузнецова Т.В., Ковалев Л.И., Лагодная Н.В.
Создание продуцента миостатина в виде слитого белка с 6His-GFP на основе Е.coli и
изучение его иммуногенности. Сборник статей «Медико-биологические технологии
повышения работоспособности в условиях напряженных физических нагрузок».
Министерство образования и науки Российской Федерации, Москва, 2004, С.140-150.
Фиг. 2
20
25
30
35
40
45
50
Ñòð.: 9
RU 2 509 805 C2
5
10
15
20
25
30
35
40
45
50
Ñòð.: 10
RU 2 509 805 C2
5
10
15
20
25
30
35
40
45
50
Ñòð.: 11
RU 2 509 805 C2
5
10
15
20
25
30
35
40
45
50
Формула изобретения
Способ получения рекомбинантного антигена G2 Хантавируса Добрава в
клетках E.coli, характеризующийся тем, что ДНК конструкции pGHF, кодирующая
слитый белок из трех частей, где N-концевое положение занимает зеленый
флуоресцентный белок GFP, центральное - пептид длиной 73 а.о. с
последовательностью
аминокислот
SRKKCNFATTPICEYDGNMVSGYKKVMATIDSFQAFNTSYIHYTDEQIEWKDPDGMLKD
HLNILVTKDIDFDT, а C-концевое - мини-домен фолдон фибритина колифага JS98C3
(фиг.2), вводят в клетки E.coli, культивируют трансформированные данной
конструкцией клетки, лизируют биомассу, отделяют нерастворимую фракцию лизата
центрифугированием, продукт экспрессии в форме телец включения солюбилизируют с
помощью денатурата, проводят хроматографию и используют полученный продукт
Ñòð.: 12
CL
RU 2 509 805 C2
для выявления специфических антител в сыворотке больных геморрагической
лихорадкой с почечным синдромом.
5
10
15
20
25
30
35
40
45
50
Ñòð.: 13
RU 2 509 805 C2
Ñòð.: 14
DR
RU 2 509 805 C2
Ñòð.: 15
RU 2 509 805 C2
Ñòð.: 16
1/--страниц
Пожаловаться на содержимое документа